| Gene | F5I10.2 |
| Identification | transmembrane protein TMP-C |
| Position | 24857 - 26245, from the initial methionine to the termination codon |
| Strand | + |
| EST match | several, possibly 36 different ESTs or more |
| Database match | transmembrane protein TMP-C, D26609 |
Note: A TBLASTN search at AtDB lists 100 ESTs with a smallest sum probability of e-44 or less. Because TMP-C is a member of a highly conserved protein family, it is difficult to assess exactly how many ESTs are represented by this gene. Nonetheless, it is clear that the various EST datasets are redundant with regard to this gene.
CDS: The table below lists the coordinates of the exons for F5I10.2
Exon |
Range |
| 1 | 24857 - 25187 |
| 2 | 25491 - 25786 |
| 3 | 25915 - 26055 |
| 4 | 26150 - 26245 |
Protein sequence of F5I10.2
MEGKEEDVRVGANKFPERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFI ATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTF GLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTPYQTLGGGANTVAHGYTKGSGLG AEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARS LGAAIIYNKDHSWDDHWIFWVGPFIGAALAALYHQIVIRAIPFKSKS*
written 7 Jan 98
Larry Parnell