| Gene | T10M13.15 |
| Putative Identification | hypothetical protein |
| Position | 76075 to 76505, from the initial methionine to the termination codon |
| Strand | - |
| EST match | none |
| Database match | --- |
CDS: The table below lists the exon coordinates of T10M13.15 and which gene prediction programs selected the 3' and 5' termini (GS = GenScan, Gr = GRAIL, M = MZEF, NPG = NetPlantGene - selects splice sites only, not exons). MZEF is not designed to predict terminal exons and the fact that MZEF fails to predict any putative exon in this region is a good indicator that T10M13.15 is a two-exon gene.
| Exon | Range | 3' | 5' |
|---|---|---|---|
| 1 | 76350 - 76505 | GS, Gr, NPG | Gr |
| 2 | 76075 - 76257 | GS, Gr | GS, Gr, NPG |
Alternate exons not used in building the gene model: GenScan concatenates T10M13.15 with the upstream gene T10M13.16. The first GenScan exon in this region extends from 76477 to 76350. GRAIL predicts a downstream exon from 75462 to 75284. MZEF predicts no exons in this region. NetPlantGene predicts no other splice sites in this region that have high confidence scores.
Complete CDS of T10M13.15
ATGCTGTCTTCACCAGCTTTTGCTGCAGCACGTTCTACTCTCGGTCGTCGTCTTCATGCG AAGAGACTATCTTCTTCTACTGGTCGAACCGCTGATCCAGAGATTCATGCCCGTAACGAT GGAGACGAGCCTAGTCTTTTTCCATCAGACCCCGAGGGTTTGGATGATGTAGCGAACCCG AAGACTCCAGCGGATGAGGATGTACCGGATATTCGACCACCCGGTTTTGTAAAGGAACCG CTTTCTCCGCCAAAAAATCCCAGAGATACTTCACACAAGCTTGAATCTACTCCCGTTGGT CTACCTGCAGATCTCAATTTCCAACAGAAACGAAATTAA
Protein translation
MLSSPAFAAARSTLGRRLHAKRLSSSTGRTADPEIHARNDGDEPSLFPSDPEGLDDVANP KTPADEDVPDIRPPGFVKEPLSPPKNPRDTSHKLESTPVGLPADLNFQQKRN*
written 30 Jul 97
updated 3 Aug 98
Larry Parnell